missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCG4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-17072-25UL
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ABCG4 Polyclonal antibody specifically detects ABCG4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| ABCG4 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ATP-binding cassette, sub-family G (WHITE), member 4, ATP-binding cassette, subfamily G, member 4, putative ABC transporter, WHITE2ATP-binding cassette sub-family G member 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSH | |
| 25 μg | |
| ABC Transporters, Lipid and Metabolism | |
| 64137 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido