missing translation for 'onlineSavingsMsg'
Learn More
Learn More
eEF-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57792
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
eEF-2 Polyclonal specifically detects eEF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Especificaciones
| eEF-2 | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EF-2, EF2EEF-2, elongation factor 2, eukaryotic translation elongation factor 2, polypeptidyl-tRNA translocase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| EEF2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG | |
| 100 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 1938 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido