missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DRA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
302.00€ - 498.00€
Especificaciones
| Antígeno | HLA DRA |
|---|---|
| Dilución | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18173948
|
Novus Biologicals
NBP2-38691 |
0.1 mL |
498.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18649025
|
Novus Biologicals
NBP2-38691-25ul |
25 μL |
302.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
HLA DRA Polyclonal specifically detects HLA DRA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| HLA DRA | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P01903 | |
| 3122 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cell Biology, Diabetes Research, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ51114, histocompatibility antigen HLA-DR alpha, HLA class II histocompatibility antigen, DR alpha chain, HLA-DRA1, major histocompatibility complex, class II, DR alpha, MHC cell surface glycoprotein, MHC class II antigen DRA, MLRW | |
| HLA-DRA | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto