Abnova™ HMGN2 Recombinant Protein

Marca: Abnova™ H00003151-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16166231

Fecha estimada de envío: 04-09-2024
para ver el stock

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH14644
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	35.6
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Inmunógeno	MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Alias de gen	HMG17/MGC5629/MGC88718
Símbolo de gen	HMGN2
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	3151
Nombre	HMGN2 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	HMGN2
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Sugerencias de productos

Descripción