missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203157

Invitrogen™ Human Adrenomedullin (aa 19-79) Control Fragment Recombinant Protein

Código de producto. 30203157
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30203157 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203157

Marca: Invitrogen™ RP109171

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140125 (PA5-140125. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adrenomedullin (ADM), a vasodilator produced by most contractile cells, is characterized by persistent hypotensive activity. ADM is involved in the regulation of fluid and electrolyte homeostasis and in the maintenance of cardiovascular functioning. In hypertensive patients, the level of ADM in plasma is upregulated. Natriuresis is a common systemic manifestation of aneurysmal subarachnoid hemorrhage. ADM has strong natriuretic actions. ADM-induced natriuresis is caused by an increase in glomerular filtration rate and a decrease in distal tubular sodium reabsorption. ADM is present both in the periphery and brain, and can exert central effects such as decreasing food ingestion.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P35318
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 133
Nombre Human Adrenomedullin (aa 19-79) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ADM; Adrenomedullin; AM; AMpreproadrenomedullin; Ap; H39316; PAMP; preproadrenomedullin; proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; ProAM-N20; RATAP
Nombre común Adrenomedullin
Símbolo de gen ADM
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.