Learn More
Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104388
176.67 EUR hasta el 2025-03-21
Use el código promocional "24111" para aplicar la oferta.
Alertas:
Para beneficiarse del descuento, los clientes deben comprar tres unidades del mismo producto al precio de catálogo en un solo pedido para recibir el 33.33% de descuento No hay límite para los múltiplos de 3 que los clientes pueden comprar PCODE:24111
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Especificaciones
P0DUB6 | |
Blocking Assay, Control | |
276 | |
100 μL | |
1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase | |
AMY1A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human alpha Amylase 1 (aa 242-300) Control Fragment | |
RUO | |
alpha Amylase 1 | |
Unconjugated | |
Recombinant | |
KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Certificados
Se requiere un número de lote para mostrar resultados para certificados. Para encontrar su número de lote en pedidos anteriores, utilice el área de estado de pedidos.
Número de lote | Tipo de certificado | Fecha | Catalog Number |
---|---|---|---|
AB4586044 | Certificado de análisis | 07/02/2025 |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.