missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human BOLL (aa 185-263) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92306
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Especificaciones
| Q8N9W6 | |
| Blocking Assay, Control | |
| 66037 | |
| 100 μL | |
| RUO | |
| BOLL | |
| Human | |
| ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAI | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| BOLL | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 4930554P13Rik; 4930597B14Rik; bol, boule-like; bol, boule-like (Drosophila); Boll; BOULE; boule homolog, RNA binding protein; boule-like RNA binding protein; boule-like RNA-binding protein; protein boule-like; RGD1559527 | |
| Unconjugated | |
| Recombinant | |
| E. coli |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido