missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human c-MAF (aa 1-112) Control Fragment Recombinant Protein

Código de producto. 30212009
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212009

Marca: Invitrogen™ RP101907

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110954 (PA5-110954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-maf is the cellular counterpart of oncogenic v-maf that belongs to the family of basic region leucine zipper domain transcription factors. The leucine-zipper domain is involved in the interaction with LRPICD. There are two forms of human c-maf mRNA, c-maf-long and c-maf-short. It is identified in the genome of the acute transforming avian retrovirus AS42. c-maf targets are IL-4 in Th2 cells, the crystalline genes in lens fiber cells, insulin gene in islet, p53 and L7 where it exerts its transcriptional role through binding to a Maf recognition element (MARE). It regulates Th2 differentiation and lineage-specific hematopoiesis. c-maf is a transcription factor for IL-10 gene expression in LPS-activated macrophages. Chromosomal aberration involving maf is found in some forms of multiple myeloma. It is expressed in myeloma cell lines and resting monocytes/macrophages.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O75444
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4094
Nombre Human c-MAF (aa 1-112) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2810401A20Rik; A230108G15Rik; Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene; avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog; AW047063; AYGRP; basic domain leucine zipper transcription factor; CCA4; cMaf; C-Maf; c-Maf long form; c-maf proto-oncogene; CTRCT21; fl13d12; hMafA; LOW QUALITY PROTEIN: transcription factor Maf; LOW QUALITY PROTEIN: transcription factor MafA; maf; MAF bZIP transcription factor; MAF bZIP transcription factor A; maf protein; Maf2; MAFA; Mafa homolog; MGC71685; pancreatic beta-cell-specific transcriptional activator; Proto-oncogene c-Maf; RGD1562627; RIPE3b1; RIPE3b1 factor; T lymphocyte c-maf long form; transcription factor Maf; Transcription factor Maf-2; transcription factor MafA; transcription factor RIPE3b1; v-maf avian musculoaponeurotic fibrosarcoma oncogene A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog a (paralog a); v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian); v-maf musculoaponeurotic fibrosarcoma oncogene homolog; V-maf musculoaponeurotic fibrosarcoma oncogene homolog A; wu:fl13d12; Z-cmaf
Nombre común c-MAF
Símbolo de gen MAF
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPED
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado