Learn More
Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102000
176.67 EUR hasta el 2025-03-21
Use el código promocional "24111" para aplicar la oferta.
Alertas:
Para beneficiarse del descuento, los clientes deben comprar tres unidades del mismo producto al precio de catálogo en un solo pedido para recibir el 33.33% de descuento No hay límite para los múltiplos de 3 que los clientes pueden comprar PCODE:24111
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52211 (PA5-52211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARMT1 gene ontology annotations related to this gene include protein carboxyl O-methyltransferase activity.
Especificaciones
Q9H993 | |
Blocking Assay, Control | |
79624 | |
100 μL | |
Acidic residue methyltransferase 1; ARMT1; C6orf211; Damage-control phosphatase ARMT1; Protein-glutamate O-methyltransferase; Sugar phosphate phosphatase ARMT1; UPF0364 protein C6orf211 | |
ARMT1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human C6orf211 (aa 259-378) Control Fragment | |
RUO | |
C6orf211 | |
Unconjugated | |
Recombinant | |
LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.