Learn More
Invitrogen™ Human CD177 Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109641
176.67 EUR hasta el 2025-03-21
Use el código promocional "24111" para aplicar la oferta.
Alertas:
Para beneficiarse del descuento, los clientes deben comprar tres unidades del mismo producto al precio de catálogo en un solo pedido para recibir el 33.33% de descuento No hay límite para los múltiplos de 3 que los clientes pueden comprar PCODE:24111
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
Especificaciones
Q8N6Q3 | |
Blocking Assay, Control | |
57126 | |
100 μL | |
1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181 | |
CD177 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CD177 Control Fragment | |
RUO | |
CD177 | |
Unconjugated | |
Recombinant | |
GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.