missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CLEC4E (aa 90-204) Control Fragment Recombinant Protein

Código de producto. 30194999
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194999

Marca: Invitrogen™ RP88577

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52135 (PA5-52135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLEC4E encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9ULY5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 26253
Nombre Human CLEC4E (aa 90-204) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C86253; CLEC4E; CLECSF9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; C-type lectin domain family 4 member E; C-type lectin domain family 4, member E; C-type lectin superfamily member 9; C-type lectin, superfamily member 9; immunoreceptor; macrophage-inducible C-type lectin; Mincle; UNQ218/PRO244
Nombre común CLEC4E
Símbolo de gen CLEC4E
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado