missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209760

Invitrogen™ Human FNIP2 (aa 677-767) Control Fragment Recombinant Protein

Código de producto. 30209760
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30209760 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209760

Marca: Invitrogen™ RP100176

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111162 (PA5-111162. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNIP2 is the second protein found to interact with folliculin, the product of the Birt-Hogg-Dube (BHD) gene. Folliculin is thought to act as a tumor suppressor as mutations or loss of heterozygosity in this gene are associated with BHD syndrome-related renal tumors. Folliculin and FNIP1, a protein that shares 49% identity to FNIP2, bind to AMPK, an important energy sensor in cells that negatively regulates the mammalian target of rapamycin (mTOR), a protein that is thought to be the master switch for cell growth and proliferation. FNIP1 and FNIP2 are able to form homo- and heteromeric multimers, suggesting these proteins may have a functional relationship.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9P278
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57600
Nombre Human FNIP2 (aa 677-767) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen D630023B12Rik; FNIP1-like protein; Fnip2; Fnipl; folliculin interacting protein 2; folliculin-interacting protein 2; KIAA1450; MAPO1; mKIAA1450; O6-methylguanine-induced apoptosis 1 protein; RGD1562174
Nombre común FNIP2
Símbolo de gen FNIP2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.