missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPR112 (aa 2430-2525) Control Fragment Recombinant Protein

Código de producto. 30198892
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198892

Marca: Invitrogen™ RP94997

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57228 (PA5-57228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors(GPRs or GPCRs), also known asseven transmembrane receptors, heptahelical receptors or 7TMreceptors, aremembers of the largest protein family and play a role in many differentstimulus-response pathways. G protein-coupled receptors mediate extracellularsignals into intracellularsignals(G protein activation). Theyrespond to awide variety of signaling molecules, including hormones, neurotransmitters and other proteins and peptides. GPR proteins are usuallyintegralseven passmembrane proteins with some conserved amino acid regions. GPR112 (G protein-coupled receptor 112) is a 3,080 amino acid multi-pass membrane protein that belongsto the G-protein coupled receptor 2 family and LN-TM7 subfamily. Localizing to cell membrane, GPR112 is highly expressed in normal enterochromaffin cells, aswell as neuroendocrine and primarylivercarcinoma. GPR112 contains one GPS domain andmayfunction as an orphan receptor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8IZF6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 139378
Nombre Human GPR112 (aa 2430-2525) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ADGRG4; adhesion G protein-coupled receptor G4; adhesion G-protein coupled receptor G4; G protein-coupled receptor 112; Gm367; GPR112; G-protein coupled receptor 112; PGR17; probable G-protein coupled receptor 112; RP1-299I16
Nombre común GPR112
Símbolo de gen ADGRG4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia INTGKSQWEKPKFKQCKLLQELPDKIVDLANITISDENAEDVAEHILNLINESPALGKEETKIIVSKISDISQCDEISMNLTHVMLQIINVVLEKQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado