missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Granzyme A (aa 154-204) Control Fragment Recombinant Protein

Código de producto. 30208152
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208152

Marca: Invitrogen™ RP103176

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P12544
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3001
Nombre Human Granzyme A (aa 154-204) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Autocrine thymic lymphoma granzyme-like serine protease; AW494114; BLT esterase; CTL tryptase; CTLA3; CTLA-3; Cytotoxic T-lymphocyte proteinase 1; Cytotoxic T-lymphocyte-associated serine esterase-3; fragmentin-1; granzyme 1; granzyme A; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); Granzyme-1; GZMA; H factor; Hanukah factor; Hanukah factor serine protease); Hanukkah factor; Hf; HFSP; Mtsp-1; SE1; serine esterase 1; t cell-specific serine protease 1; TSP1; TSP-1
Nombre común Granzyme A
Símbolo de gen GZMA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado