missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HEY1 (aa 157-217) Control Fragment Recombinant Protein

Código de producto. 30212826
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212826

Marca: Invitrogen™ RP95672

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111421 (PA5-111421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hairy/enhancer-of-split related with YRPW motif protein 1 belongs to the HEY family and is a Notch Signaling Pathway Protein. It contains one basic helix-loop-helix (bHLH) domain and one Orange domain. It is a downstream effector of Notch signaling which may be required for cardiovascular development. It acts as transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. It represses transcription by the cardiac transcriptional activators GATA4 and GATA6. Hey1 is also reported to be expressed during development of the nervous system.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y5J3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23462
Nombre Human HEY1 (aa 157-217) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI316788; AI414254; basic helix-loop-helix protein OAF1; basic helix-loop-helix transcription factor; BC8; bHLH protein Hesr-1/Hey1; bHLHb31; cardiovascular basic helix-loop-helix factor 2; cardiovascular helix-loop-helix factor 2; CHF2; CHF-2; class B basic helix-loop-helix protein 31; Hairy and enhancer of split-related protein 1; Hairy/E(spl)-related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif protein 1; hairy-related transcription factor 1; Herp1; Herp2; hes related family bHLH transcription factor with YRPW motif 1; Hesr1; HESR-1; hes-related family bHLH transcription factor with YRPW motif 1; HES-related repressor protein 1; HES-related repressor protein 2; HEY1; hey1 protein; hHRT1; HRT1; HRT-1; id:ibd1292; MGC1274; mHRT1; OAF1; zgc:110572
Nombre común HEY1
Símbolo de gen HEY1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado