missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LIPF Partial ORF (NP_004181, 299 a.a. - 398 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
Número de acceso | NP_004181 |
---|---|
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 8513 |
Peso molecular | 36.74kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16168695
|
Abnova™
H00008513-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 04-09-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
16158695
|
Abnova™
H00008513-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 04-09-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. [provided by RefSeq]
Sequence: KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKKEspecificaciones
NP_004181 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GL/HGL/HLAL/MGC138477/MGC142271 | |
LIPF | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
8513 | |
LIPF (Human) Recombinant Protein (Q01) | |
KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK | |
RUO | |
LIPF | |
Wheat Germ (in vitro) | |
GST | |
Liquid |