missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Human Neuropeptide Y/NPY Antibody, R&D Systems™
Mouse Monoclonal Antibody
Marca: R&D Systems MAB8517
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Neuropeptide Y Monoclonal specifically detects Neuropeptide Y in Human samples. It is validated for Immunohistochemistry.
Especificaciones
| Neuropeptide Y | |
| Monoclonal | |
| Unconjugated | |
| Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative | |
| 170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, NPY, PYY4, seprase | |
| Mouse | |
| Protein A or G purified from hybridoma culture supernatant | |
| RUO | |
| 4852 | |
| Reconstitute at 0.5 mg/mL in sterile PBS. | |
| Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. | |
| IgG2a |
| Immunohistochemistry | |
| 904032 | |
| Immunohistochemistry 8-25 ug/mL | |
| P01303 | |
| NPY | |
| Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303 | |
| 100 μg | |
| Primary | |
| Detects human Neuropeptide Y/NPY in direct ELISAs. | |
| Human | |
| Supernatant |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Human Neuropeptide Y/NPY Antibody, R&D Systems™ > 100μg
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
