missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP91392
176.67 EUR hasta el 2025-03-21
Use el código promocional "24111" para aplicar la oferta.
Alertas:
Para beneficiarse del descuento, los clientes deben comprar tres unidades del mismo producto al precio de catálogo en un solo pedido para recibir el 33.33% de descuento No hay límite para los múltiplos de 3 que los clientes pueden comprar PCODE:24111
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein remains unknown.
Especificaciones
| Q9Y3I0 | |
| Blocking Assay, Control | |
| 51493 | |
| 100 μL | |
| 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871 | |
| Rtcb | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RTCB (aa 340-499) Control Fragment | |
| RUO | |
| RTCB | |
| Unconjugated | |
| Recombinant | |
| PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Viewing 1-5 of 11
-
Catalog No. 10678484
205,00 € / 500 ml -
Catalog No. 13464189
105,00 € / paquete de 5 -
Catalog No. 10647894
280,00 € / 250 ml -
Catalog No. 11560626
21,11 € / 100 ml -
Catalog No. 11580626
16,32 € / 100 ml -
Catalog No. 11548876
20,57 € / 100 ml -
Catalog No. 10729174
311,00 € / 500 microlitros -
Catalog No. 15137105
9.870,00 € / cada uno -
Catalog No. 11514270
862,00 € / 100 microlitros -
Catalog No. 17821163
Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech
226,00 € / 100 microgramos -
Catalog No. 17833373
Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech
87,25 € / 100 microgramos
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
