missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC1A3 Partial ORF (NP_004163.2, 162 a.a. - 237 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006507-Q01.10ug
This item is not returnable.
View return policy
Description
Glutamate and aspartate are excitatory neurotransmitters that have been implicated in a number of pathologic states of the nervous system. Accumulation of extracellular excitatory amino acids can be cytotoxic and may also lower the seizure threshold in epilepsy. EAAT1 (SLC1A3) is a member of a family of high-affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system (Kirschner et al., 1994 [PubMed 8001975]).[supplied by OMIM]
Sequence: VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSSpecifications
| NP_004163.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.1kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS | |
| RUO | |
| SLC1A3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6507 | |
| SLC1A3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EA6/EAAT1/FLJ25094/GLAST/GLAST1 | |
| SLC1A3 | |
| Recombinant | |
| wheat germ expression system |