Learn More
Invitrogen™ Human TLR10 (aa 23-100) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109112
176.67 EUR hasta el 2025-03-21
Use el código promocional "24111" para aplicar la oferta.
Alertas:
Para beneficiarse del descuento, los clientes deben comprar tres unidades del mismo producto al precio de catálogo en un solo pedido para recibir el 33.33% de descuento No hay límite para los múltiplos de 3 que los clientes pueden comprar PCODE:24111
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139881 (PA5-139881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Its exact function is not known. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Especificaciones
Q9BXR5 | |
Blocking Assay, Control | |
81793 | |
100 μL | |
CD290; MGC104967; MGC126398; MGC126399; TLR10; toll like receptor 10; toll-like receptor 10; UNQ315/PRO358 | |
TLR10 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TLR10 (aa 23-100) Control Fragment | |
RUO | |
TLR10 | |
Unconjugated | |
Recombinant | |
ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.