missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBAP2L (aa 1018-1088) Control Fragment Recombinant Protein

Código de producto. 30206967
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206967

Marca: Invitrogen™ RP94295

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57141 (PA5-57141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NICE4, also known as UBAP2L (Ubiquitin-associated protein 2-like) orKIAA0144, is a 1,087 amino acid protein that is ubiquitously expressed. Phosphorylated upon DNA damage, NICE4 contains one UBA domain and is expressed as 4 isoforms produced by alternative splicing events. The gene that encodes NICE4 maps to human chromosome 1. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes Lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14157
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9898
Nombre Human UBAP2L (aa 1018-1088) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3110083O19Rik; 4932431F02Rik; A430103N23Rik; Atp8b2; Atpase, class I, type 8 B, member 2; C77168; EP1; KIAA0144; mKIAA0144; NICE4; NICE-4; Nice-4 protein homolog; Protein NICE-4; Ubap2l; ubiquitin associated protein 2 like; ubiquitin associated protein 2-like; ubiquitin-associated protein 2-like
Nombre común UBAP2L
Símbolo de gen UBAP2L
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado