Abnova™ Human UCHL5 Partial ORF (NP_057068, 214 a.a. - 313 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00051377-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16116926

Fecha estimada de envío: 04-09-2024
para ver el stock

Descripción

Sequence: GEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLV

Especificaciones

Número de acceso	NP_057068
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	36.74kDa
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	GEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLV
Estado normativo	RUO
Nombre común	UCHL5
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Para utilizar con (aplicación)	Antibody Production, ELISA, Protein Array, Western Blot
ID de gen (Entrez)	51377
Nombre	UCHL5 (Human) Recombinant Protein (Q01)
Cantidad	25 ug
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	CGI-70/INO80R/UCH37
Símbolo de gen	UCHL5
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Sugerencias de productos

Descripción