missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ KLRD1 (Human) Recombinant Protein
Human KLRD1 full-length ORF ( AAH28009, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00003824-P01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
- Sequence: MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Especificaciones
AAH28009 | |
killer cell lectin-like receptor subfamily D, member 1 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KLRD1 | |
GST |
3824 | |
Wheat germ expression system | |
25 μg | |
CD94 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido