missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lamin B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-48966-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Lamin B1 Polyclonal antibody specifically detects Lamin B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| Lamin B1 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ADLD, lamin B1, lamin-B1, LMN, LMN2, LMNB, MGC111419 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK | |
| 25 μL | |
| Apoptosis, Cancer, Core ESC Like Genes, Loading Controls, Stem Cell Markers, Tumor Suppressors | |
| 4001 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido