missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKP-1/DUSP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57354
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MKP-1/DUSP1 Polyclonal specifically detects MKP-1/DUSP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Especificaciones
| MKP-1/DUSP1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| DUSP1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS | |
| 100 μL | |
| Cell Cycle and Replication, Protein Phosphatase | |
| 1843 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido