missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Mouse Vegfa (120 amino acids) Recombinant Protein
Used for Func, SDS-PAGE
Marca: Abnova™ P4633.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKRPRREspecificaciones
Functional Study, SDS-PAGE | |
22339 | |
Vegfa (Mouse) Recombinant Protein | |
10 ug | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
Vegfa | |
The activity is determined by the dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) and is typically 1-5ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Lyophilized | |
28.2kDa | |
Escherichia coli expression system | |
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR | |
RUO | |
Vegf/Vegf-a/Vegf120/Vegf164/Vegf188/Vpf | |
Vegfa | |
E. coli | |
None | |
Lyophilized |