missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Mouse Vegfa (165 amino acids) (AAA40547) Recombinant Protein
Used for Func, SDS-PAGE
Marca: Abnova™ P4608.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRREspecificaciones
| AAA40547 | |
| Lyophilized | |
| 39kDa | |
| Escherichia coli expression system | |
| 10 ug | |
| Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
| <0.1 EU/μg | |
| Vegfa | |
| The activity is determined by the dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.9-2.8ng/mL. | |
| Recombinant | |
| Escherichia coli expression system |
| Functional Study, SDS-PAGE | |
| 22339 | |
| Vegfa (Mouse) Recombinant Protein | |
| 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue | |
| MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR | |
| RUO | |
| Vegf/Vegf-a/Vegf120/Vegf164/Vegf188/Vpf | |
| Vegfa | |
| E. coli | |
| None | |
| Lyophilized |