missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ORF1 FL49 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-13898
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ORF1 FL49 Polyclonal specifically detects ORF1 FL49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| ORF1 FL49 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| chromosome 5 open reading frame 32, hypothetical protein LOC84418, ORF1-FL49, putative nuclear protein ORF1-FL49 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84418 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CYSTM1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido