missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pax5/BSAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
353.00€ - 552.00€
Especificaciones
| Antígeno | Pax5/BSAP |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|
18652466
|
Novus Biologicals
NBP2-38790-25ul |
25 μL |
353.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18009843
|
Novus Biologicals
NBP2-38790 |
0.1 mL |
552.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Description
Pax5/BSAP Polyclonal specifically detects Pax5/BSAP in Human, Rat, Hamster samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Pax5/BSAP | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat, Hamster | |
| Q02548 | |
| 5079 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5 | |
| PAX5 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title