Abnova™ PCSK4 (Human) Recombinant Protein

Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00054760-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16170733

Fecha estimada de envío: 04-09-2024
para ver el stock

Descripción

Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT

Especificaciones

Número de acceso	AAH36354
Nombre	proprotein convertase subtilisin/kexin type 4
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	PCSK4
Etiqueta de proteína	GST

ID de gen (Entrez)	54760
Método de preparación	Wheat germ expression system
Cantidad	25 μg
Alias de gen	DKFZp434B217, MGC34749, PC4, SPC5
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción