missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57020-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
PKR Polyclonal specifically detects PKR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| PKR | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| double stranded RNA activated protein kinase, EC 2.7.11.1, eIF-2A protein kinase 2, EIF2AK1, eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase, interferon-induced, double-stranded RNA-activated protein kinase, interferon-inducible double stranded RNA dependent, interferon-inducible elF2alpha kinase, Interferon-inducible RNA-dependent protein kinase, PKRp68 kinase, PRKRMGC126524, Protein kinase RNA-activated | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| EIF2AK2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD | |
| 25 μL | |
| Apoptosis, Signal Transduction | |
| 5610 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido