missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marca: Novus Biologicals™ NBP2-57833PEP
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAR gamma/NR1C3. Source: E.coli Amino Acid Sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC The PPAR gamma/NR1C3 Recombinant Protein Antigen is derived from E. coli. The PPAR gamma/NR1C3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones
| 5468 | |
| PPAR gamma/NR1C3 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4 | |
| CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, P | |
| Unlabeled | |
| 100 μl | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles | |
| Blocking/Neutralizing, Control | |
| PPARG | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50015. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen > Quantity: 100μL
Para uso exclusivo en investigación.
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido