missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human AlphaB Crystallin/CRYAB Protein
Highly purified. Generating reliable and reproducible results.
Marca: Novus Biologicals™ NBC1-18352
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
An un-tagged recombinant protein corresponding to the amino acids 1-175 of Human AlphaB Crystallin/CRYAB The Recombinant Human AlphaB Crystallin/CRYAB Protein is derived from E. coli. The Recombinant Human AlphaB Crystallin/CRYAB Protein has been validated for the following applications: SDS-Page.Especificaciones
NP_001876.1 | |
20mM Tris-HCl buffer (pH 7.5), 50mM NaCl, 1mM EDTA | |
20.1kDa | |
Protein | |
−80°C. Avoid freeze-thaw cycles. | |
>95%, by SDS-PAGE |
ELISA, SDS-PAGE | |
1410 | |
AlphaB Crystallin/CRYAB protein | |
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK | |
Human |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido