missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human PRL R Protein
A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.
137.00€ - 5100.00€
Especificaciones
Nombre | PRL R Protein |
---|---|
Estado normativo | Research Use Only |
Concentración de endotoxinas | < 1.0 EU per ug protein as determined by the LAL method. |
Actividad biológica | Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. |
Tipo de producto | Recombinant Protein |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
15945348
|
enQuireBio™
QP10846-5ug |
5 μg |
137.00€
5 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
15935348
|
enQuireBio™
QP10846-20ug |
20 μg |
212.00€
20 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
15925348
|
enQuireBio™
QP10846-1mg |
1 mg |
5100.00€
1 miligramo |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Especificaciones
PRL R Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW | |
Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions. |
Research Use Only | |
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. | |
Human | |
Untagged | |
The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3. |