missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Mouse Adiponectin/Acrp30 Protein
Tienda Bio Techne Productos
Click to view available options
Tamaño de la unidad:
0.50 miligramo
Descripción
An un-tagged recombinant protein corresponding to the amino acids 111-247 of Mouse Adiponectin/Acrp30 The Recombinant Mouse Adiponectin/Acrp30 Protein is derived from E. coli. The Recombinant Mouse Adiponectin/Acrp30 Protein has been validated for the following applications: SDS-Page.
Especificaciones
Especificaciones
| Para utilizar con (aplicación) | Western Blot |
| Formulación | 20mM Tris-HCl buffer (pH 7.5) 50mM NaCl, 5mM DTT, 10% glycerol |
| ID de gen (Entrez) | 9370 |
| Peso molecular | 16kDa |
| Nombre | Adiponectin/Acrp30 protein |
| Método de purificación | Protein |
| Inmunógeno | MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Requisitos de almacenamiento | -80°C. Avoid freeze-thaw cycles. |
| Reactividad cruzada | Mouse |
| Grado de pureza o calidad | >95%, by SDS-PAGE |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido