missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Marca: Novus Biologicals NBP1-94007
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SKAP Polyclonal specifically detects SKAP in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| SKAP | |
| Polyclonal | |
| Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| C15orf23, chromosome 15 open reading frame 23, FLJ14502, HSD11, MGC141728, MGC141729, putative TRAF4-associated factor 1, SKAP, small kinetochore associated protein, TRAF4 associated factor 1, TRAF4AF1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 90417 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| KNSTRN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido