missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TopBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55483
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
TopBP1 Polyclonal specifically detects TopBP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| TopBP1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1, KIAA0259DNA topoisomerase 2-binding protein 1, TOP2BP1, TopBP1, topoisomerase (DNA) II binding protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 11073 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TOPBP1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido