missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Reg4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Especificaciones
Antígeno | Reg4 |
---|---|
Dilución | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18684346
|
Novus Biologicals
NBP2-38552-25ul |
25 μL |
359.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
18110659
|
Bio-Techne
NBP2-38552 |
0.1 mL |
515.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Reg4 Polyclonal specifically detects Reg4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
Reg4 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q9BYZ8 | |
83998 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Immunology | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Gastrointestinal secretory protein, GISPREG-4, Reg IV, regenerating gene type IV, regenerating islet-derived family, member 4, regenerating islet-derived protein 4, Regenerating islet-derived protein IV, REG-IV, RELPREG-like protein | |
REG4 | |
IgG | |
Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Reg4 Antibody, Novus Biologicals™