missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Reg4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP2-38552
This item is not returnable.
View return policy
Description
Reg4 Polyclonal specifically detects Reg4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Reg4 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q9BYZ8 | |
| REG4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP | |
| 0.1 mL | |
| Immunology | |
| 83998 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Gastrointestinal secretory protein, GISPREG-4, Reg IV, regenerating gene type IV, regenerating islet-derived family, member 4, regenerating islet-derived protein 4, Regenerating islet-derived protein IV, REG-IV, RELPREG-like protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Reg4 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
