missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
For use in research applications
Marca: Novus Biologicals™ NBP2-29331-5MG
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción

Especificaciones
Human, Mouse | |
Inhibition of TIRAP binding to TLR2 or TLR4 | |
5 mg | |
3701.4 | |
Liofilizado |
TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set | |
TLR2, TLR4 |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Viewing 1-4 of
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set > 5mg
Para uso exclusivo en investigación
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido