Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.

Marca: Abnova H00055103-D01P.100ug

Código de producto. 16177886

351.00€ / 100 microgramos

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Sequence: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYK

Especificaciones

Antígeno	Ral GEF with PH domain and SH3 binding motif 2
Clasificación	Polyclonal
Descripción	Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.
génica	RALGPS2
Alias de gen	FLJ10244/FLJ25604/KIAA0351/dJ595C2.1
Especie del huésped	Rabbit
Método de purificación	Affinity Purified
Estado normativo	RUO
Primario o secundario	Primary
Especies diana	Human
Tipo de producto	Antibody

Aplicaciones	Western Blot
Conjugado	Unconjugated
Formulación	PBS with no preservative; pH 7.4
N.º de referencia del gen	NM_018037
Símbolos de los genes	RALGPS2
Inmunógeno	RALGPS2 (NP_060507.1, 1 a.a. ∼ 279 a.a) full-length human protein.
Cantidad	100 μg
Disciplina de investigación	Signal Transduction
ID de gen (Entrez)	55103
Contenido y almacenamiento	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Sugerencias de productos

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500 ml
Catalog No. 10671531

Thermo Scientific ™ Patrones de tamaño Nanosph Thermo Scientific ™ Patrones de tamaño Nanosph

703,00 € / 15 ml
Catalog No. 13464189

Thermo Scientific ™ Mezcla de proteasas tripsi Thermo Scientific ™ Mezcla de proteasas tripsi

105,00 € / paquete de 5
Catalog No. 10647894

Thermo Scientific ™ Solución de sustrato para Thermo Scientific ™ Solución de sustrato para

280,00 € / 250 ml
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1 ml
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100 microgramos
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5 miligramos
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100 microgramos
Catalog No. 15137105

Applied Biosystems ™ Sistema de PCR ProFlex ™ Applied Biosystems ™ Sistema de PCR ProFlex ™

9.870,00 € / cada uno
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

345,00 € / cada uno
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100 microlitros

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™ > 100μg; Unlabeled

Su nombre

Dirección de correo electrónico *

Tipo de problema *

Descripción detallada del problema/solicitud *

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Cancelar Enviar

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado

¿Detecta una oportunidad de mejora?Comparta una corrección de contenido

Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Descripción

Especificaciones

Sugerencias de productos

Documentos

Ofertas especiales

Artículos vistos recientemente...Mostrar