missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Phenylalanine Hydroxylase Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marca: Novus Biologicals™ NBP1-80917PEP
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAH. Source: E.coli Amino Acid Sequence: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG The Phenylalanine Hydroxylase Recombinant Protein Antigen is derived from E. coli. The Phenylalanine Hydroxylase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-80917. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Especificaciones
5053 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
PAH | |
34kDa | |
0.1 mL | |
E.Coli | |
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
Phenylalanine Hydroxylase | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80917. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Sugerencias de productos
Los clientes que vieron este artículo también vieron
Viewing 1-4 of
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Novus Biologicals™ Phenylalanine Hydroxylase Recombinant Protein Antigen > 0.1mL
Para uso exclusivo en investigación
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido