1
–
15
de
208
resultados

RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 350, Novus Biologicals™
Rabbit Monoclonal Antibody
Bromodeoxyuridine/BrdU Antibody (BU-1) [Alexa Fluor™ 532], Novus Biologicals™
Mouse Monoclonal Antibody
Primario o secundario | Primary |
---|---|
Formulación | 10mM PBS with 0.05% BSA |
Método de purificación | Protein A or G purified |
Concentración | 0.2 mg/ml |
Inmunógeno | Recombinant fragment (around aa1-84) of human TFF1/pS2 protein (exact sequence is proprietary) |
Dilución | Immunohistochemistry-Paraffin 1-2 μg/mL |
Formulario | Purified |
Clon | TFF1/7891 |
Isotype | IgG |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 7031 |
Antígeno | TFF1/pS2 |
Disciplina de investigación | Breast Cancer, Cancer |
Aplicaciones | Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4&drg;C. Do not freeze. |
Alias de gen | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
Primario o secundario | Primary |
---|---|
Formulación | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Método de purificación | Protein A or G purified from hybridoma culture supernatant |
Inmunógeno | E. coli-derived recombiMouset mouse IL-36 alpha/IL-1F6, Met1-His160, Accession # Q9JLA2 |
Dilución | ELISA |
Formulario | Purified |
Clon | 275302 |
Isotype | IgG2a |
Especie del huésped | Rat |
Conjugado | Unconjugated |
ID de gen (Entrez) | 27179 |
Antígeno | IL-36 alpha/IL-1F6 |
N.º de referencia del gen | Q9JLA2 |
Aplicaciones | ELISA |
Reconstitución | Reconstitute at 0.5 mg/mL in sterile PBS. |
Contenido y almacenamiento | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Alias de gen | FIL1, FIL1 epsilon, FIL1(EPSILON), FIL1E, IL-1 epsilon, IL1(EPSILON), IL1E, IL-1E, IL1F6, IL-1F6, IL-1F6 (FIL-1-epsilon), IL36 alpha, IL36A, interleukin 1 family, member 6 (epsilon), interleukin 1, epsilon, Interleukin 36, Alpha, Interleukin-1 epsilon, interleukin-1 family member 6, Interleukin-36 Alpha |
Especies diana | Mouse |
Estado normativo | RUO |
Clasificación | Monoclonal |
Primario o secundario | Primary |
---|---|
Formulación | 10mM PBS with 0.05% BSA |
Método de purificación | Protein A or G purified |
Concentración | 0.2 mg/ml |
Inmunógeno | Recombinant fragment (around aa384-584) of human Cytokeratin 10 protein (exact sequence is proprietary) |
Dilución | Immunohistochemistry-Paraffin 1-2 μg/mL |
Formulario | Purified |
Clon | rKRT10/6923 |
Isotype | IgG1 κ |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 3858 |
Antígeno | Cytokeratin 10 |
Disciplina de investigación | Cell Biology, Cellular Markers |
Aplicaciones | Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4&drg;C. Do not freeze. |
Alias de gen | BCIE, BIE, CK10, CK-10, cytokeratin 10, Cytokeratin-10, EHK, K10keratosis palmaris et plantaris, keratin 10, Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris), keratin, type I cytoskeletal 10, keratin-10, KPP |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.3), 50% glycerol |
Método de purificación | Affinity purified |
Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Dilución | Western Blot 1:500-1:2000 |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 10787 |
Antígeno | NCKAP1 |
Disciplina de investigación | Apoptosis |
Aplicaciones | Western Blot |
Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
Alias de gen | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Polyclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS with 50% glycerol, pH7.3. |
Método de purificación | Affinity purified |
Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CYTB (YP_003024038.1). RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL |
Dilución | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 4519 |
Antígeno | CYTB |
Disciplina de investigación | Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction |
Aplicaciones | Western Blot,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
Alias de gen | cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Polyclonal |
Primario o secundario | Primary |
---|---|
Formulación | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Método de purificación | Protein A or G purified from hybridoma culture supernatant |
Inmunógeno | Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554 |
Dilución | Immunohistochemistry 3-25 ug/mL |
Formulario | Purified |
Clon | 2906A |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 1823 |
Antígeno | Desmocollin-1 |
N.º de referencia del gen | Q08554 |
Aplicaciones | Immunohistochemistry |
Reconstitución | Reconstitute at 0.5 mg/mL in sterile PBS. |
Contenido y almacenamiento | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Alias de gen | cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1 |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |