1
–
15
de
208
resultados

Requisitos de almacenamiento | Store at -80°C. Avoid freeze-thaw cycles. |
---|---|
Formulación | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Expresión | DNA Polymerase iota |
Símbolo de gen | POLI |
Alias de gen | DNA polymerase iota, EC 2.7.7.7, Eta2, polymerase (DNA directed) iota, RAD30 homolog B, RAD30Bpolymerase (DNA-directed), iota, RAD3OB |
ID de gen (Entrez) | 11201 |
Categoría de investigación | DNA Polymerases, DNA Repair |
Grado de pureza o calidad | >80% by SDS-PAGE and Coomassie blue staining |
Peso molecular | MolecularWeight-theroretical: 106.7 kDa |
Para utilizar con (aplicación) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
Primario o secundario | Primary |
---|---|
Formulación | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Método de purificación | Protein A or G purified from cell culture supernatant |
Inmunógeno | Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222 |
Dilución | Immunohistochemistry 5-25 ug/mL |
Formulario | Purified |
Clon | 2771C |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 5551 |
Antígeno | Perforin |
N.º de referencia del gen | P14222 |
Aplicaciones | Immunohistochemistry |
Reconstitución | Reconstitute at 0.5 mg/mL in sterile PBS. |
Contenido y almacenamiento | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Alias de gen | Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1 |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody
Primario o secundario | Primary |
---|---|
Formulación | 10mM PBS with 0.05% BSA |
Método de purificación | Protein A or G purified |
Concentración | 0.2 mg/ml |
Inmunógeno | Recombinant fragment (around aa1-84) of human TFF1/pS2 protein (exact sequence is proprietary) |
Dilución | Immunohistochemistry-Paraffin 1-2 μg/mL |
Formulario | Purified |
Clon | TFF1/7891 |
Isotype | IgG |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 7031 |
Antígeno | TFF1/pS2 |
Disciplina de investigación | Breast Cancer, Cancer |
Aplicaciones | Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4&drg;C. Do not freeze. |
Alias de gen | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.3), 50% glycerol |
Método de purificación | Affinity purified |
Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Dilución | Western Blot 1:500-1:2000 |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 10787 |
Antígeno | NCKAP1 |
Disciplina de investigación | Apoptosis |
Aplicaciones | Western Blot |
Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
Alias de gen | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Polyclonal |
R&D Systems™ H/M Pluripotent Stem Cell Multi-Color Flow Cytometry Kit
For single-step staining of human/mouse pluripotent stem cells (h/mPSCs) (1-7)
Primario o secundario | Primary |
---|---|
Formulación | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Método de purificación | Protein A or G purified from hybridoma culture supernatant |
Inmunógeno | Mouse myeloma cell line NS0-derived recombinant human Aggrecan, Val20-Gly675, Accession # NP_037359 |
Dilución | ELISA |
Formulario | Purified |
Clon | 179503 |
Isotype | IgG1 |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 176 |
Antígeno | Aggrecan |
N.º de referencia del gen | NP_037359 |
Aplicaciones | ELISA |
Reconstitución | Reconstitute at 0.5 mg/mL in sterile PBS. |
Contenido y almacenamiento | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Alias de gen | ACAN, AGC1, AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16, MSK16AGCAN, SEDK |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
Bromodeoxyuridine/BrdU Antibody (BU-1) [Alexa Fluor™ 532], Novus Biologicals™
Mouse Monoclonal Antibody
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 350, Novus Biologicals™
Rabbit Monoclonal Antibody
Primario o secundario | Primary |
---|---|
Formulación | 0.2 um filtered solution in PBS |
Método de purificación | Antigen and protein A Affinity-purified |
Inmunógeno | Produced in rabbits immunized with purified, recombinant Mouse SPARC-like 1/SPARCL1 (Accession#: EDL20231.1; Met1-Phe650) |
Dilución | ELISA 1:5000-1:10000 |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 8404 |
Antígeno | SPARC-like 1/SPARCL1 |
Disciplina de investigación | Cancer |
Aplicaciones | ELISA |
Contenido y almacenamiento | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Alias de gen | hevin, High endothelial venule protein, MAST 9, MAST9, PIG33, proliferation-inducing protein 33, SC1, SPARC-like 1 (hevin), SPARC-like 1 (mast9, hevin), SPARC-like protein 1 |
Especies diana | Mouse |
Estado normativo | RUO |
Clasificación | Polyclonal |
Novus Biologicals™ alpha Satellite Repeat Primer
alpha SAT primer for PCR in chromatin precipitation
Tipo de producto | alpha Satellite Repeat Primer |
---|---|
Contenido y almacenamiento | Store at –20°C. Avoid Free/Thaw Cycles |
Para utilizar con (aplicación) | Chromatin Immunoprecipitation |
Purine Nucleoside Phosphorylase/PNP Antibody (103), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody